SCOPe 2.08: Domain d1teaa3: 1tea A:3-163

Lineage for d1teaa3 (1tea A:3-163)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Hydroxyisobutyrate dehydrogenase [102171] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [110431] (2 PDB entries)
   Uniprot Q8ZLV8

8. Domain d1teaa3: 1tea A:3-163 [303084]
   Other proteins in same PDB: d1teaa4
   automated match to d1vpda2
   complexed with cl, tar

Details for d1teaa3

PDB Entry: 1tea, 1.65 Å

PDB Description: X-ray crystal structure of tartronate semialdehyde reductase [Salmonella typhimurium LT2]

PDB Compounds: (A:) tartronate semialdehyde reductase

SCOPe Domain Sequences for d1teaa3:

Sequence; same for both SEQRES and ATOM records:

>d1teaa3 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]}
mkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiaeqcdvi
itmlpnsphvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvemldapv
sggepkaidgtlsvmvggdkaifdkyydlmkamagsvvhtg

Timeline for d1teaa3:

• d1teaa3 first appeared in SCOPe 2.06
  
• d1teaa3 appears in SCOPe 2.07