Lineage for d1teaa3 (1tea A:3-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844998Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2845080Protein Hydroxyisobutyrate dehydrogenase [102171] (4 species)
  7. 2845086Species Salmonella typhimurium [TaxId:90371] [110431] (2 PDB entries)
    Uniprot Q8ZLV8
  8. 2845087Domain d1teaa3: 1tea A:3-163 [303084]
    Other proteins in same PDB: d1teaa4
    automated match to d1vpda2
    complexed with cl, tar

Details for d1teaa3

PDB Entry: 1tea (more details), 1.65 Å

PDB Description: X-ray crystal structure of tartronate semialdehyde reductase [Salmonella typhimurium LT2]
PDB Compounds: (A:) tartronate semialdehyde reductase

SCOPe Domain Sequences for d1teaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1teaa3 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]}
mkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiaeqcdvi
itmlpnsphvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvemldapv
sggepkaidgtlsvmvggdkaifdkyydlmkamagsvvhtg

SCOPe Domain Coordinates for d1teaa3:

Click to download the PDB-style file with coordinates for d1teaa3.
(The format of our PDB-style files is described here.)

Timeline for d1teaa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1teaa4