![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
![]() | Protein Transglutaminase catalytic domain [54045] (4 species) |
![]() | Species Human (Homo sapiens), TGase E3 [TaxId:9606] [75334] (9 PDB entries) |
![]() | Domain d1sgxa6: 1sgx A:141-461 [303067] Other proteins in same PDB: d1sgxa5, d1sgxa7, d1sgxa8, d1sgxb5, d1sgxb7, d1sgxb8 automated match to d1l9ma4 complexed with 5gp, ca, mg |
PDB Entry: 1sgx (more details), 2 Å
SCOPe Domain Sequences for d1sgxa6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgxa6 d.3.1.4 (A:141-461) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]} dsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqfeedilsiclsildrslnfrr daatdvasrndpkyvgrvlsaminsnddngvlagnwsgtytggrdprswngsveilknwk ksglspvrygqcwvfagtlntalrslgipsrvitnfnsahdtdrnlsvdvyydpmgnpld kgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqersqgvfqcgpasvigvregdvq lnfdmpfifaevnadritwlydnttgkqwknsvnshtigryistkavgsnarmdvtdkyk ypegsdqerqvfqkalgklkp
Timeline for d1sgxa6:
![]() Domains from other chains: (mouse over for more information) d1sgxb5, d1sgxb6, d1sgxb7, d1sgxb8 |