Lineage for d1se1b4 (1se1 B:426-543)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484065Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2484117Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species)
  7. 2484118Species Escherichia coli [TaxId:316407] [186806] (2 PDB entries)
  8. 2484120Domain d1se1b4: 1se1 B:426-543 [303065]
    Other proteins in same PDB: d1se1a3, d1se1b3
    automated match to d1vrsd_

Details for d1se1b4

PDB Entry: 1se1 (more details), 2.85 Å

PDB Description: Crystal structure of the disulfide-linked complex between the N-terminal and C-terminal domain of the electron transfer catalyst DsbD
PDB Compounds: (B:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1se1b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se1b4 c.47.1.1 (B:426-543) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 316407]}
qthlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvqkaladtv
llqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrd

SCOPe Domain Coordinates for d1se1b4:

Click to download the PDB-style file with coordinates for d1se1b4.
(The format of our PDB-style files is described here.)

Timeline for d1se1b4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1se1b3