Lineage for d1se1b3 (1se1 B:1-125)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032092Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families) (S)
  5. 2032093Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 protein domains)
  6. 2032094Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species)
  7. 2032095Species Escherichia coli [TaxId:562] [74866] (6 PDB entries)
  8. 2032101Domain d1se1b3: 1se1 B:1-125 [303064]
    Other proteins in same PDB: d1se1a4, d1se1b4
    automated match to d1vrsa_

Details for d1se1b3

PDB Entry: 1se1 (more details), 2.85 Å

PDB Description: Crystal structure of the disulfide-linked complex between the N-terminal and C-terminal domain of the electron transfer catalyst DsbD
PDB Compounds: (B:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1se1b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se1b3 b.1.17.1 (B:1-125) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
evvan

SCOPe Domain Coordinates for d1se1b3:

Click to download the PDB-style file with coordinates for d1se1b3.
(The format of our PDB-style files is described here.)

Timeline for d1se1b3:

  • d1se1b3 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d1se1b4