![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families) ![]() |
![]() | Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins) |
![]() | Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [74866] (6 PDB entries) |
![]() | Domain d1se1b3: 1se1 B:1-125 [303064] Other proteins in same PDB: d1se1a4, d1se1b4 automated match to d1vrsa_ |
PDB Entry: 1se1 (more details), 2.85 Å
SCOPe Domain Sequences for d1se1b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1se1b3 b.1.17.1 (B:1-125) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]} glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls evvan
Timeline for d1se1b3: