SCOPe 2.08: Domain d1se1b3: 1se1 B:1-125

Lineage for d1se1b3 (1se1 B:1-125)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families)

5. Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)

6. Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species)

7. Species Escherichia coli [TaxId:562] [74866] (6 PDB entries)

8. Domain d1se1b3: 1se1 B:1-125 [303064]
   Other proteins in same PDB: d1se1a4, d1se1b4
   automated match to d1vrsa_

Details for d1se1b3

PDB Entry: 1se1, 2.85 Å

PDB Description: Crystal structure of the disulfide-linked complex between the N-terminal and C-terminal domain of the electron transfer catalyst DsbD

PDB Compounds: (B:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1se1b3:

Sequence; same for both SEQRES and ATOM records:

>d1se1b3 b.1.17.1 (B:1-125) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
evvan

Timeline for d1se1b3:

• d1se1b3 first appeared in SCOPe 2.06
  
• d1se1b3 appears in SCOPe 2.07