![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (42 species) not a true protein |
![]() | Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries) |
![]() | Domain d1scth_: 1sct H: [303061] automated match to d4hrrb_ complexed with cmo, hem |
PDB Entry: 1sct (more details), 2 Å
SCOPe Domain Sequences for d1scth_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1scth_ a.1.1.2 (H:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} kvaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvsa gkdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgplr qtlkarmgnyfdedtvaawaslvavvqasl
Timeline for d1scth_: