SCOP 1.69: Domain d1cqja1: 1cqj A:1-121

Lineage for d1cqja1 (1cqj A:1-121)

Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)
Family c.2.1.8: CoA-binding domain [51900] (2 proteins)
Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species)
Species Escherichia coli [TaxId:562] [51902] (6 PDB entries)
Domain d1cqja1: 1cqj A:1-121 [30305]
Other proteins in same PDB: d1cqja2, d1cqjb1, d1cqjb2, d1cqjd2, d1cqje1, d1cqje2

Details for d1cqja1

PDB Entry: 1cqj (more details), 2.9 Å

PDB Description: crystal structure of dephosphorylated e. coli succinyl-coa synthetase

SCOP Domain Sequences for d1cqja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqja1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOP Domain Coordinates for d1cqja1:

Click to download the PDB-style file with coordinates for d1cqja1.
(The format of our PDB-style files is described here.)

Timeline for d1cqja1: