Lineage for d1sagd_ (1sag D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000691Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 2000692Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 2000693Family a.53.1.1: p53 tetramerization domain [47720] (1 protein)
  6. 2000694Protein p53 tetramerization domain [47721] (1 species)
  7. 2000695Species Human (Homo sapiens) [TaxId:9606] [47722] (17 PDB entries)
  8. 2000704Domain d1sagd_: 1sag D: [303049]
    automated match to d3saka_

Details for d1sagd_

PDB Entry: 1sag (more details)

PDB Description: high resolution solution nmr structure of the oligomerization domain of p53 by multi-dimensional nmr (sac structures)
PDB Compounds: (D:) tumor suppressor p53

SCOPe Domain Sequences for d1sagd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sagd_ a.53.1.1 (D:) p53 tetramerization domain {Human (Homo sapiens) [TaxId: 9606]}
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg

SCOPe Domain Coordinates for d1sagd_:

Click to download the PDB-style file with coordinates for d1sagd_.
(The format of our PDB-style files is described here.)

Timeline for d1sagd_: