| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.53: p53 tetramerization domain [47718] (1 superfamily) core: 4 helices; bundle |
Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) ![]() homotetramer |
| Family a.53.1.1: p53 tetramerization domain [47720] (1 protein) |
| Protein p53 tetramerization domain [47721] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47722] (18 PDB entries) |
| Domain d1sagb_: 1sag B: [303047] automated match to d3saka_ |
PDB Entry: 1sag (more details)
SCOPe Domain Sequences for d1sagb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sagb_ a.53.1.1 (B:) p53 tetramerization domain {Human (Homo sapiens) [TaxId: 9606]}
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg
Timeline for d1sagb_: