Lineage for d2scud1 (2scu D:1-121)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) 
Family c.2.1.8: Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51900] (1 protein) Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (2 species) 
Species Escherichia coli [TaxId:562] [51902] (4 PDB entries) 
Domain d2scud1: 2scu D:1-121 [30304]
Other proteins in same PDB: d2scua2, d2scub1, d2scub2, d2scud2, d2scue1, d2scue2
Details for d2scud1
PDB Entry: 2scu (more details), 2.3 Å
PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli
SCOP Domain Sequences for d2scud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2scud1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p
SCOP Domain Coordinates for d2scud1:
Click to download the PDB-style file with coordinates for d2scud1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2scud1:
- d2scud1 appears in SCOP 1.57
- d2scud1 appears in the current release, SCOPe 2.07
View in 3D
