Lineage for d1s0ka3 (1s0k A:1-399)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.1: Sialidases [50939] (3 families) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) 
Protein Trypanosoma sialidase [82164] (2 species) Species Trypanosoma cruzi [TaxId:5693] [89371] (13 PDB entries)
Uniprot Q26966
Domain d1s0ka3: 1s0k A:1-399 [303038]
Other proteins in same PDB: d1s0ka4
automated match to d1ms3a2
complexed with fsi, gol
Details for d1s0ka3
PDB Entry: 1s0k (more details), 1.6 Å
PDB Description: Trypanosoma cruzi trans-sialidase in complex with 2,3-difluorosialic acid (covalent intermediate)
PDB Compounds: (A:) Trans-sialidaseSCOPe Domain Sequences for d1s0ka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0ka3 b.68.1.1 (A:1-399) Trypanosoma sialidase {Trypanosoma cruzi [TaxId: 5693]}
lapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdn
slidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsyw
tshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggag
vaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkl
iintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvm
lfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheins
nevyslvfarlvgelriiksvlqswknwdshlssictpa
SCOPe Domain Coordinates for d1s0ka3:
Click to download the PDB-style file with coordinates for d1s0ka3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s0ka3:
- d1s0ka3 first appeared in SCOPe 2.06
- d1s0ka3 appears in SCOPe 2.07
View in 3D
