SCOPe 2.08: Domain d1rw6a_: 1rw6 A:

Lineage for d1rw6a_ (1rw6 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.47: STAT-like [47654] (6 superfamilies)
   4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix

4. Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families)
   the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965)

5. Family a.47.4.1: CAPPD, an extracellular domain of amyloid beta A4 protein [109844] (2 proteins)
   automatically mapped to Pfam PF12925

6. Protein CAPPD, an extracellular domain of amyloid beta A4 protein [109845] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109846] (3 PDB entries)
   Uniprot P05067 374-569 # structures are known for other fragments: 28-123 (56494); 124-189 (89814); 287-344 (57371); 681-/-711 ((58608))

8. Domain d1rw6a_: 1rw6 A: [303036]
   automated match to d3nyla_
   has additional insertions and/or extensions that are not grouped together

Details for d1rw6a_

PDB Entry: 1rw6, 2.8 Å

PDB Description: human APP core domain

PDB Compounds: (A:) amyloid beta a4 protein

SCOPe Domain Sequences for d1rw6a_:

Sequence; same for both SEQRES and ATOM records:

>d1rw6a_ a.47.4.1 (A:) CAPPD, an extracellular domain of amyloid beta A4 protein {Human (Homo sapiens) [TaxId: 9606]}
avdkyletpgdenehahfqkakerleakhrermsqvmreweeaerqaknlpkadkkaviq
hfqekvesleqeaanerqqlvethmarveamlndrrrlalenyitalqavpprprhvfnm
lkkyvraeqkdrqhtlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllynvpa
vaeeiqdevdel

Timeline for d1rw6a_:

• d1rw6a_ first appeared in SCOPe 2.06
  
• d1rw6a_ appears in SCOPe 2.07