SCOPe 2.08: Domain d1ru8b1: 1ru8 B:3-229

Lineage for d1ru8b1 (1ru8 B:3-229)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein Putative N-type ATP pyrophosphatase PF0828 [102264] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [102265] (5 PDB entries)

8. Domain d1ru8b1: 1ru8 B:3-229 [303034]
   Other proteins in same PDB: d1ru8a2, d1ru8b2
   automated match to d3rjza_
   complexed with trs
   has additional subdomain(s) that are not in the common domain

Details for d1ru8b1

PDB Entry: 1ru8, 2.7 Å

PDB Description: Crystal Structure of the putative n-type ATP pyrophosphatase from Pyrococcus furiosus, the Northeast Structural Genomics Target PfR23

PDB Compounds: (B:) putative n-type ATP pyrophosphatase

SCOPe Domain Sequences for d1ru8b1:

Sequence, based on SEQRES records:

>d1ru8b1 c.26.2.1 (B:3-229) Putative N-type ATP pyrophosphatase PF0828 {Pyrococcus furiosus [TaxId: 2261]}
gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaral
giplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytp
awgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvag
eggefetfvldmplfkykivvdkakkvwepctssgkliieeahlesk

Sequence, based on observed residues (ATOM records):

>d1ru8b1 c.26.2.1 (B:3-229) Putative N-type ATP pyrophosphatase PF0828 {Pyrococcus furiosus [TaxId: 2261]}
gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymytinanltdlqaralg
iplvkgftqgekekevedlkrvlsglkiqgivagaskyqrkriekvakelglevytpawg
rdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvagegg
efetfvldmplfkykivvdkakkvwepctssgkliieeahlesk

Timeline for d1ru8b1:

• d1ru8b1 first appeared in SCOPe 2.06
  
• d1ru8b1 appears in SCOPe 2.07