Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
Protein Putative N-type ATP pyrophosphatase PF0828 [102264] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [102265] (5 PDB entries) |
Domain d1ru8a1: 1ru8 A:3-229 [303032] Other proteins in same PDB: d1ru8a2, d1ru8b2 automated match to d3rjza_ complexed with trs has additional subdomain(s) that are not in the common domain |
PDB Entry: 1ru8 (more details), 2.7 Å
SCOPe Domain Sequences for d1ru8a1:
Sequence, based on SEQRES records: (download)
>d1ru8a1 c.26.2.1 (A:3-229) Putative N-type ATP pyrophosphatase PF0828 {Pyrococcus furiosus [TaxId: 2261]} gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaral giplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytp awgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvag eggefetfvldmplfkykivvdkakkvwepctssgkliieeahlesk
>d1ru8a1 c.26.2.1 (A:3-229) Putative N-type ATP pyrophosphatase PF0828 {Pyrococcus furiosus [TaxId: 2261]} gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymytinanltdlqaralg iplvkgftqgekekevedlkrvlsglkiqgivagaskyqrkriekvakelglevytpawg rdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvagegg efetfvldmplfkykivvdkakkvwepctssgkliieeahlesk
Timeline for d1ru8a1: