![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins) |
![]() | Protein Adenine glycosylase MutY, C-terminal domain [103212] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [103213] (5 PDB entries) |
![]() | Domain d1rrta4: 1rrt A:234-360 [303031] Other proteins in same PDB: d1rrta3 automated match to d1rrsa2 protein/DNA complex; complexed with a, ca, fs4 |
PDB Entry: 1rrt (more details), 2.5 Å
SCOPe Domain Sequences for d1rrta4:
Sequence, based on SEQRES records: (download)
>d1rrta4 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglq veltepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwr eykewas
>d1rrta4 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} vkqvplavavladdegrvlirkrdstgllanlwefpscetddgkekleqmvglqveltep ivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreykewa s
Timeline for d1rrta4: