Lineage for d1rrta4 (1rrt A:234-360)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211741Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins)
  6. 2211745Protein Adenine glycosylase MutY, C-terminal domain [103212] (1 species)
  7. 2211746Species Bacillus stearothermophilus [TaxId:1422] [103213] (5 PDB entries)
  8. 2211751Domain d1rrta4: 1rrt A:234-360 [303031]
    Other proteins in same PDB: d1rrta3
    automated match to d1rrsa2
    protein/DNA complex; complexed with a, ca, fs4

Details for d1rrta4

PDB Entry: 1rrt (more details), 2.5 Å

PDB Description: MutY adenine glycosylase in complex with DNA and soaked adenine free base
PDB Compounds: (A:) MutY

SCOPe Domain Sequences for d1rrta4:

Sequence, based on SEQRES records: (download)

>d1rrta4 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglq
veltepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwr
eykewas

Sequence, based on observed residues (ATOM records): (download)

>d1rrta4 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetddgkekleqmvglqveltep
ivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreykewa
s

SCOPe Domain Coordinates for d1rrta4:

Click to download the PDB-style file with coordinates for d1rrta4.
(The format of our PDB-style files is described here.)

Timeline for d1rrta4: