SCOPe 2.07: Domain d1rrta3: 1rrt A:9-230

Lineage for d1rrta3 (1rrt A:9-230)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)

6. Protein Catalytic domain of MutY [48155] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [101348] (5 PDB entries)

8. Domain d1rrta3: 1rrt A:9-230 [303030]
   Other proteins in same PDB: d1rrta4
   automated match to d1rrsa1
   protein/DNA complex; complexed with a, ca, fs4

Details for d1rrta3

PDB Entry: 1rrt, 2.5 Å

PDB Description: MutY adenine glycosylase in complex with DNA and soaked adenine free base

PDB Compounds: (A:) MutY

SCOPe Domain Sequences for d1rrta3:

Sequence; same for both SEQRES and ATOM records:

>d1rrta3 a.96.1.2 (A:9-230) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkmk

Timeline for d1rrta3:

• d1rrta3 first appeared in SCOPe 2.06
  
• d1rrta3 appears in the current release, SCOPe 2.08