Lineage for d1rrta3 (1rrt A:9-230)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003278Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2003279Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2003287Family a.96.1.2: Mismatch glycosylase [48154] (4 protein domains)
  6. 2003288Protein Catalytic domain of MutY [48155] (2 species)
  7. 2003289Species Bacillus stearothermophilus [TaxId:1422] [101348] (5 PDB entries)
  8. 2003294Domain d1rrta3: 1rrt A:9-230 [303030]
    Other proteins in same PDB: d1rrta4
    automated match to d1rrsa1
    protein/DNA complex; complexed with a, ca, fs4

Details for d1rrta3

PDB Entry: 1rrt (more details), 2.5 Å

PDB Description: MutY adenine glycosylase in complex with DNA and soaked adenine free base
PDB Compounds: (A:) MutY

SCOPe Domain Sequences for d1rrta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrta3 a.96.1.2 (A:9-230) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkmk

SCOPe Domain Coordinates for d1rrta3:

Click to download the PDB-style file with coordinates for d1rrta3.
(The format of our PDB-style files is described here.)

Timeline for d1rrta3:

  • d1rrta3 is new in SCOPe 2.06-stable