SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1roxa_ (1rox A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2035040Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2035041Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 protein domains)
    automatically mapped to Pfam PF00576
  6. 2035042Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2035063Species Human (Homo sapiens) [TaxId:9606] [49475] (259 PDB entries)
    Uniprot P02766 31-143
  8. 2035404Domain d1roxa_: 1rox A: [303025]
    automated match to d1ttaa_
    complexed with so4, t44

Details for d1roxa_

PDB Entry: 1rox (more details), 2 Å

PDB Description: human transthyretin complexed with thyroxine
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d1roxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1roxa_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke

SCOPe Domain Coordinates for d1roxa_:

Click to download the PDB-style file with coordinates for d1roxa_.
(The format of our PDB-style files is described here.)

Timeline for d1roxa_:

  • d1roxa_ is new in SCOPe 2.06-stable