Lineage for d1rmia_ (1rmi A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2319033Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2319062Protein Interferon-beta [47309] (2 species)
  7. 2319066Species Mouse (Mus musculus) [TaxId:10090] [47311] (4 PDB entries)
    Uniprot P01575 22-182
    CA-atoms only
  8. 2319067Domain d1rmia_: 1rmi A: [303020]
    automated match to d3wcyi_

Details for d1rmia_

PDB Entry: 1rmi (more details), 2.15 Å

PDB Description: refined crystal structure of recombinant murine interferon-b at 2.15 angstroms resolution and its relationship to those of the other type i interferons
PDB Compounds: (A:) interferon-beta

SCOPe Domain Sequences for d1rmia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rmia_ a.26.1.3 (A:) Interferon-beta {Mouse (Mus musculus) [TaxId: 10090]}
inykqlqlqertnirkcqelleqlngkinltyradfkipmemtekmqksytafaiqemlq
nvflvfrnnfsstgwnetivvrlldelhqqtvflktvleekqeerltwemsstalhlksy
ywrvqrylklmkynsyawmvvraeifrnfliirrltrnfq

SCOPe Domain Coordinates for d1rmia_:

Click to download the PDB-style file with coordinates for d1rmia_.
(The format of our PDB-style files is described here.)

Timeline for d1rmia_: