SCOPe 2.06: Domain d1efkd1: 1efk D:280-573

Lineage for d1efkd1 (1efk D:280-573)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
includes C-terminal additional subdomains
Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)
Domain d1efkd1: 1efk D:280-573 [30302]
Other proteins in same PDB: d1efka2, d1efkb2, d1efkc2, d1efkd2
complexed with mak, mg, nad

Details for d1efkd1

PDB Entry: 1efk (more details), 2.6 Å

PDB Description: structure of human malic enzyme in complex with ketomalonate

PDB Compounds: (D:) malic enzyme

SCOPe Domain Sequences for d1efkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efkd1 c.2.1.7 (D:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

SCOPe Domain Coordinates for d1efkd1:

Click to download the PDB-style file with coordinates for d1efkd1.
(The format of our PDB-style files is described here.)

Timeline for d1efkd1: