SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1rm7a_ (1rm7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149073Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
    automatically mapped to Pfam PF03767
  6. 2149074Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 2149075Species Escherichia coli [TaxId:562] [102309] (13 PDB entries)
    Uniprot P32697 27-237
  8. 2149094Domain d1rm7a_: 1rm7 A: [303018]
    automated match to d1rmta_
    complexed with adn, au3, mg, po4, spm

Details for d1rm7a_

PDB Entry: 1rm7 (more details), 2.03 Å

PDB Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate at 2 A resolution
PDB Compounds: (A:) Class B acid phosphatase

SCOPe Domain Sequences for d1rm7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm7a_ c.108.1.12 (A:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
girilrasnstykplpqagafgeevivnsey

SCOPe Domain Coordinates for d1rm7a_:

Click to download the PDB-style file with coordinates for d1rm7a_.
(The format of our PDB-style files is described here.)

Timeline for d1rm7a_:

  • d1rm7a_ is new in SCOPe 2.06-stable