Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) automatically mapped to Pfam PF00927 |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (9 PDB entries) |
Domain d1rllb3: 1rll B:473-593 [303016] Other proteins in same PDB: d1rlla1, d1rlla2, d1rllb1, d1rllb2 automated match to d1l9mb2 complexed with ca, gsp, mg |
PDB Entry: 1rll (more details), 1.9 Å
SCOPe Domain Sequences for d1rllb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rllb3 b.1.5.1 (B:473-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]} leteeqepsiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhe vwkdsatmsldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiild n
Timeline for d1rllb3:
View in 3D Domains from other chains: (mouse over for more information) d1rlla1, d1rlla2, d1rlla3, d1rlla4 |