| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) ![]() automatically mapped to Pfam PF00927 |
| Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
| Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
| Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (9 PDB entries) |
| Domain d1rlla3: 1rll A:479-593 [303012] Other proteins in same PDB: d1rlla1, d1rlla2, d1rllb1, d1rllb2 automated match to d1l9ma2 complexed with ca, gsp, mg |
PDB Entry: 1rll (more details), 1.9 Å
SCOPe Domain Sequences for d1rlla3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlla3 b.1.5.1 (A:479-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
epsiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsa
tmsldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildn
Timeline for d1rlla3:
View in 3DDomains from other chains: (mouse over for more information) d1rllb1, d1rllb2, d1rllb3, d1rllb4 |