| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
| Protein Transglutaminase catalytic domain [54045] (4 species) |
| Species Human (Homo sapiens), TGase E3 [TaxId:9606] [75334] (9 PDB entries) |
| Domain d1rlla2: 1rll A:141-461 [303011] Other proteins in same PDB: d1rlla1, d1rlla3, d1rlla4, d1rllb1, d1rllb3, d1rllb4 automated match to d1l9ma4 complexed with ca, gsp, mg |
PDB Entry: 1rll (more details), 1.9 Å
SCOPe Domain Sequences for d1rlla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlla2 d.3.1.4 (A:141-461) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
dsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqfeedilsiclsildrslnfrr
daatdvasrndpkyvgrvlsaminsnddngvlagnwsgtytggrdprswdgsveilknwk
ksglspvrygqcwvfagtlntalrslgipsrvitnfnsahdtdrnlsvdvyydpmgnpld
kgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqersqgvfqcgpasvigvregdvq
lnfdmpfifaevnadritwlydnttgkqwknsvnshtigryistkavgsnarmdvtdkyk
ypegsdqerqvfqkalgklkp
Timeline for d1rlla2:
View in 3DDomains from other chains: (mouse over for more information) d1rllb1, d1rllb2, d1rllb3, d1rllb4 |