| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) ![]() automatically mapped to Pfam PF00927 |
| Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
| Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
| Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (9 PDB entries) |
| Domain d1rlea8: 1rle A:594-692 [303005] Other proteins in same PDB: d1rlea5, d1rlea6, d1rleb5, d1rleb6 automated match to d1l9ma3 complexed with ca, gsp, mg |
PDB Entry: 1rle (more details), 2.1 Å
SCOPe Domain Sequences for d1rlea8:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlea8 b.1.5.1 (A:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
ptltlevlnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpker
srvrfdilpsrsgtkqlladfscnkfpaikamlsidvae
Timeline for d1rlea8:
View in 3DDomains from other chains: (mouse over for more information) d1rleb5, d1rleb6, d1rleb7, d1rleb8 |