Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (9 PDB entries) |
Domain d1rlea5: 1rle A:1-140 [303002] Other proteins in same PDB: d1rlea6, d1rlea7, d1rlea8, d1rleb6, d1rleb7, d1rleb8 automated match to d1l9ma1 complexed with ca, gsp, mg |
PDB Entry: 1rle (more details), 2.1 Å
SCOPe Domain Sequences for d1rlea5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlea5 b.1.18.9 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]} aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg gissvklgtfillfnpwlnv
Timeline for d1rlea5:
View in 3D Domains from other chains: (mouse over for more information) d1rleb5, d1rleb6, d1rleb7, d1rleb8 |