SCOPe 2.06: Domain d1rlea5: 1rle A:1-140

Lineage for d1rlea5 (1rle A:1-140)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)

6. Protein Transglutaminase N-terminal domain [49235] (4 species)
   elaborated with many loop insertions in the common fold

7. Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (9 PDB entries)

8. Domain d1rlea5: 1rle A:1-140 [303002]
   Other proteins in same PDB: d1rlea6, d1rlea7, d1rlea8, d1rleb6, d1rleb7, d1rleb8
   automated match to d1l9ma1
   complexed with ca, gsp, mg

Details for d1rlea5

PDB Entry: 1rle, 2.1 Å

PDB Description: Structural Basis for the Coordinated Regulation of Transglutaminase 3 by Guanine Nucleotides and Calcium/Magnesium

PDB Compounds: (A:) Protein-glutamine glutamyltransferase E

SCOPe Domain Sequences for d1rlea5:

Sequence; same for both SEQRES and ATOM records:

>d1rlea5 b.1.18.9 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

Timeline for d1rlea5:

• d1rlea5 is new in SCOPe 2.06-stable
  
• d1rlea5 appears in SCOPe 2.07
  
• d1rlea5 appears in the current release, SCOPe 2.08