![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46619] (35 PDB entries) |
![]() | Domain d1rfwb1: 1rfw B:1-83 [303000] Other proteins in same PDB: d1rfwa2, d1rfwb2 automated match to d1szxa1 complexed with mw1 |
PDB Entry: 1rfw (more details), 2.2 Å
SCOPe Domain Sequences for d1rfwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rfwb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial qpalkfnggghinhsifwtnlsp
Timeline for d1rfwb1: