SCOPe 2.08: Domain d1efka1: 1efk A:280-573

Lineage for d1efka1 (1efk A:280-573)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
   includes C-terminal additional subdomains

7. Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)

8. Domain d1efka1: 1efk A:280-573 [30299]
   Other proteins in same PDB: d1efka2, d1efkb2, d1efkc2, d1efkd2
   complexed with mak, mg, nad
   has additional subdomain(s) that are not in the common domain

Details for d1efka1

PDB Entry: 1efk, 2.6 Å

PDB Description: structure of human malic enzyme in complex with ketomalonate

PDB Compounds: (A:) malic enzyme

SCOPe Domain Sequences for d1efka1:

Sequence; same for both SEQRES and ATOM records:

>d1efka1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

Timeline for d1efka1:

• d1efka1 first appeared (with stable ids) in SCOP 1.55
  
• d1efka1 appears in SCOPe 2.07