![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.3: Sec7 domain [48425] (2 families) ![]() |
![]() | Family a.118.3.1: Sec7 domain [48426] (6 proteins) Pfam PF01369 |
![]() | Protein Exchange factor ARNO [48427] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48428] (6 PDB entries) |
![]() | Domain d1r8re_: 1r8r E: [302987] Other proteins in same PDB: d1r8ra_ automated match to d1s9de_ complexed with afb, gdp, mg |
PDB Entry: 1r8r (more details), 1.8 Å
SCOPe Domain Sequences for d1r8re_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8re_ a.118.3.1 (E:) Exchange factor ARNO {Human (Homo sapiens) [TaxId: 9606]} ktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdylg ereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcnp gvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnlyd sirnepfkipedd
Timeline for d1r8re_: