Lineage for d1r7ka_ (1r7k A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966432Family d.96.1.3: DHN aldolase/epimerase [55628] (3 proteins)
    beta-sheets of four subunits form a barrel, closed: n=16, S=16
    automatically mapped to Pfam PF02152
  6. 2966491Protein automated matches [310846] (1 species)
    not a true protein
  7. 2966492Species Mycobacterium tuberculosis [311175] (1 PDB entry)
  8. 2966493Domain d1r7ka_: 1r7k A: [302984]
    automated match to d1nbua_
    complexed with acy

Details for d1r7ka_

PDB Entry: 1r7k (more details), 2.5 Å

PDB Description: Tetrameric Structure of Apo-7,8-Dihydroneopterin aldolase from Mycobacterium tuberculosis
PDB Compounds: (A:) Probable dihydroneopterin aldolase

SCOPe Domain Sequences for d1r7ka_:

Sequence, based on SEQRES records: (download)

>d1r7ka_ d.96.1.3 (A:) automated matches {Mycobacterium tuberculosis}
adrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasra
aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsrr

Sequence, based on observed residues (ATOM records): (download)

>d1r7ka_ d.96.1.3 (A:) automated matches {Mycobacterium tuberculosis}
adrielrgltvhggqrfvidvtvwidlaeaansddladtydyvrlasraaeivagpprkl
ietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsrr

SCOPe Domain Coordinates for d1r7ka_:

Click to download the PDB-style file with coordinates for d1r7ka_.
(The format of our PDB-style files is described here.)

Timeline for d1r7ka_: