| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
| Family d.96.1.3: DHN aldolase/epimerase [55628] (3 proteins) beta-sheets of four subunits form a barrel, closed: n=16, S=16 automatically mapped to Pfam PF02152 |
| Protein automated matches [310846] (1 species) not a true protein |
| Species Mycobacterium tuberculosis [311175] (1 PDB entry) |
| Domain d1r7ka_: 1r7k A: [302984] automated match to d1nbua_ complexed with acy |
PDB Entry: 1r7k (more details), 2.5 Å
SCOPe Domain Sequences for d1r7ka_:
Sequence, based on SEQRES records: (download)
>d1r7ka_ d.96.1.3 (A:) automated matches {Mycobacterium tuberculosis}
adrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasra
aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsrr
>d1r7ka_ d.96.1.3 (A:) automated matches {Mycobacterium tuberculosis}
adrielrgltvhggqrfvidvtvwidlaeaansddladtydyvrlasraaeivagpprkl
ietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsrr
Timeline for d1r7ka_: