Lineage for d1r72f3 (1r72 F:3-77)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983713Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)
  6. 1983714Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
    AT-rich DNA-binding protein p25
  7. 1983715Species Thermus aquaticus [TaxId:271] [101009] (3 PDB entries)
    Uniprot Q9X2V5; # CASP5
  8. 1983730Domain d1r72f3: 1r72 F:3-77 [302980]
    Other proteins in same PDB: d1r72a4, d1r72b4, d1r72c4, d1r72d4, d1r72e4, d1r72f4, d1r72g4
    automated match to d1xcba1
    complexed with ca, mg, nad

Details for d1r72f3

PDB Entry: 1r72 (more details), 2.9 Å

PDB Description: Crystal Structure of p25 from Thermus aquaticus
PDB Compounds: (F:) AT-rich DNA-binding protein p25

SCOPe Domain Sequences for d1r72f3:

Sequence, based on SEQRES records: (download)

>d1r72f3 a.4.5.38 (F:3-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvgy
tvpvlkrelrhilgl

Sequence, based on observed residues (ATOM records): (download)

>d1r72f3 a.4.5.38 (F:3-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygytvpvl
krelrhilgl

SCOPe Domain Coordinates for d1r72f3:

Click to download the PDB-style file with coordinates for d1r72f3.
(The format of our PDB-style files is described here.)

Timeline for d1r72f3: