Lineage for d1efld1 (1efl D:280-573)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845344Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
    includes C-terminal additional subdomains
  7. 2845362Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)
  8. 2845380Domain d1efld1: 1efl D:280-573 [30298]
    Other proteins in same PDB: d1efla2, d1eflb2, d1eflc2, d1efld2
    complexed with mg, nad, ttn
    has additional subdomain(s) that are not in the common domain

Details for d1efld1

PDB Entry: 1efl (more details), 2.6 Å

PDB Description: human malic enzyme in a quaternary complex with nad, mg, and tartronate
PDB Compounds: (D:) malic enzyme

SCOPe Domain Sequences for d1efld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efld1 c.2.1.7 (D:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

SCOPe Domain Coordinates for d1efld1:

Click to download the PDB-style file with coordinates for d1efld1.
(The format of our PDB-style files is described here.)

Timeline for d1efld1: