SCOPe 2.07: Domain d1r72d4: 1r72 D:78-204

Lineage for d1r72d4 (1r72 D:78-204)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.12: Transcriptional repressor Rex, C-terminal domain [102174] (2 proteins)
   automatically mapped to Pfam PF02629

6. Protein Transcriptional repressor Rex, C-terminal domain [102175] (1 species)
   forms swapped dimer with C-terminal helices

7. Species Thermus aquaticus [TaxId:271] [102176] (3 PDB entries)
   Uniprot Q9X2V5
   CASP5

8. Domain d1r72d4: 1r72 D:78-204 [302977]
   Other proteins in same PDB: d1r72a3, d1r72b3, d1r72c3, d1r72d3, d1r72e3, d1r72f3, d1r72g3
   automated match to d1xcba2
   complexed with ca, mg, nad

Details for d1r72d4

PDB Entry: 1r72, 2.9 Å

PDB Description: Crystal Structure of p25 from Thermus aquaticus

PDB Compounds: (D:) AT-rich DNA-binding protein p25

SCOPe Domain Sequences for d1r72d4:

Sequence; same for both SEQRES and ATOM records:

>d1r72d4 c.2.1.12 (D:78-204) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]}
nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv
pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls
failnpk

Timeline for d1r72d4:

• d1r72d4 first appeared in SCOPe 2.06
  
• d1r72d4 appears in the current release, SCOPe 2.08