| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.12: Transcriptional repressor Rex, C-terminal domain [102174] (2 proteins) automatically mapped to Pfam PF02629 |
| Protein Transcriptional repressor Rex, C-terminal domain [102175] (1 species) forms swapped dimer with C-terminal helices |
| Species Thermus aquaticus [TaxId:271] [102176] (3 PDB entries) Uniprot Q9X2V5 CASP5 |
| Domain d1r72d4: 1r72 D:78-204 [302977] Other proteins in same PDB: d1r72a3, d1r72b3, d1r72c3, d1r72d3, d1r72e3, d1r72f3, d1r72g3 automated match to d1xcba2 complexed with ca, mg, nad |
PDB Entry: 1r72 (more details), 2.9 Å
SCOPe Domain Sequences for d1r72d4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r72d4 c.2.1.12 (D:78-204) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]}
nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv
pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls
failnpk
Timeline for d1r72d4: