Lineage for d1r72b4 (1r72 B:78-206)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454131Family c.2.1.12: Transcriptional repressor Rex, C-terminal domain [102174] (2 proteins)
    automatically mapped to Pfam PF02629
  6. 2454132Protein Transcriptional repressor Rex, C-terminal domain [102175] (1 species)
    forms swapped dimer with C-terminal helices
  7. 2454133Species Thermus aquaticus [TaxId:271] [102176] (3 PDB entries)
    Uniprot Q9X2V5
    CASP5
  8. 2454144Domain d1r72b4: 1r72 B:78-206 [302973]
    Other proteins in same PDB: d1r72a3, d1r72b3, d1r72c3, d1r72d3, d1r72e3, d1r72f3, d1r72g3
    automated match to d1xcba2
    complexed with ca, mg, nad

Details for d1r72b4

PDB Entry: 1r72 (more details), 2.9 Å

PDB Description: Crystal Structure of p25 from Thermus aquaticus
PDB Compounds: (B:) AT-rich DNA-binding protein p25

SCOPe Domain Sequences for d1r72b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r72b4 c.2.1.12 (B:78-206) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]}
nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv
pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls
failnpkwr

SCOPe Domain Coordinates for d1r72b4:

Click to download the PDB-style file with coordinates for d1r72b4.
(The format of our PDB-style files is described here.)

Timeline for d1r72b4: