Lineage for d1r2va4 (1r2v A:240-307)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2186175Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2186176Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2186324Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 2186357Species Sheep (Ovis aries) [TaxId:9940] [109621] (17 PDB entries)
    Uniprot Q6TMG6
  8. 2186360Domain d1r2va4: 1r2v A:240-307 [302967]
    Other proteins in same PDB: d1r2va3
    automated match to d1sr0a2

Details for d1r2va4

PDB Entry: 1r2v (more details), 2.07 Å

PDB Description: Crystal structure of a secretory 40kDa glycoprotein from sheep mammary gland at 2.0A resolution
PDB Compounds: (A:) signal processing protein

SCOPe Domain Sequences for d1r2va4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2va4 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOPe Domain Coordinates for d1r2va4:

Click to download the PDB-style file with coordinates for d1r2va4.
(The format of our PDB-style files is described here.)

Timeline for d1r2va4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r2va3