Lineage for d1r2va3 (1r2v A:1-239,A:308-362)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831708Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2831895Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 2831929Species Sheep (Ovis aries) [TaxId:9940] [109611] (17 PDB entries)
    Uniprot Q6TMG6
  8. 2831931Domain d1r2va3: 1r2v A:1-239,A:308-362 [302966]
    Other proteins in same PDB: d1r2va4
    automated match to d1sr0a1

Details for d1r2va3

PDB Entry: 1r2v (more details), 2.07 Å

PDB Description: Crystal structure of a secretory 40kDa glycoprotein from sheep mammary gland at 2.0A resolution
PDB Compounds: (A:) signal processing protein

SCOPe Domain Sequences for d1r2va3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2va3 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlaev

SCOPe Domain Coordinates for d1r2va3:

Click to download the PDB-style file with coordinates for d1r2va3.
(The format of our PDB-style files is described here.)

Timeline for d1r2va3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r2va4