SCOPe 2.08: Domain d1qq8a_: 1qq8 A:

Lineage for d1qq8a_ (1qq8 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein automated matches [190372] (2 species)
   not a true protein

7. Species Homo sapiens [311174] (1 PDB entry)

8. Domain d1qq8a_: 1qq8 A: [302962]
   automated match to d1ni6c_
   complexed with cl, hem

Details for d1qq8a_

PDB Entry: 1qq8, 2.08 Å

PDB Description: x-ray crystal structure of human heme oxygenase-1 (ho-1) in complex with its substrate heme

PDB Compounds: (A:) protein (heme oxygenase)

SCOPe Domain Sequences for d1qq8a_:

Sequence; same for both SEQRES and ATOM records:

>d1qq8a_ a.132.1.1 (A:) automated matches {Homo sapiens}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1qq8a_:

• d1qq8a_ first appeared in SCOPe 2.06
  
• d1qq8a_ appears in SCOPe 2.07