Lineage for d1qq8a_ (1qq8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732618Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2732758Protein automated matches [190372] (2 species)
    not a true protein
  7. 2732759Species Homo sapiens [311174] (1 PDB entry)
  8. 2732760Domain d1qq8a_: 1qq8 A: [302962]
    automated match to d1ni6c_
    complexed with cl, hem

Details for d1qq8a_

PDB Entry: 1qq8 (more details), 2.08 Å

PDB Description: x-ray crystal structure of human heme oxygenase-1 (ho-1) in complex with its substrate heme
PDB Compounds: (A:) protein (heme oxygenase)

SCOPe Domain Sequences for d1qq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qq8a_ a.132.1.1 (A:) automated matches {Homo sapiens}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d1qq8a_:

Click to download the PDB-style file with coordinates for d1qq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1qq8a_: