Lineage for d1eflb1 (1efl B:280-573)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20664Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 20741Protein Mitochondrial NAD(P)-dependenent malic enzyme [51898] (1 species)
  7. 20742Species Human (Homo sapiens) [TaxId:9606] [51899] (4 PDB entries)
  8. 20750Domain d1eflb1: 1efl B:280-573 [30296]
    Other proteins in same PDB: d1efla2, d1eflb2, d1eflc2, d1efld2

Details for d1eflb1

PDB Entry: 1efl (more details), 2.6 Å

PDB Description: human malic enzyme in a quaternary complex with nad, mg, and tartronate

SCOP Domain Sequences for d1eflb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eflb1 c.2.1.7 (B:280-573) Mitochondrial NAD(P)-dependenent malic enzyme {Human (Homo sapiens)}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

SCOP Domain Coordinates for d1eflb1:

Click to download the PDB-style file with coordinates for d1eflb1.
(The format of our PDB-style files is described here.)

Timeline for d1eflb1: