Lineage for d1qmka_ (1qmk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086002Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 protein domains)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 2086003Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. 2086004Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51596] (12 PDB entries)
  8. 2086015Domain d1qmka_: 1qmk A: [302954]
    automated match to d1h7ra_
    complexed with pb

Details for d1qmka_

PDB Entry: 1qmk (more details), 2.5 Å

PDB Description: yeast 5-aminolaevulinic acid dehydratase lead (pb) complex
PDB Compounds: (A:) 5-aminolaevulinic acid dehydratase

SCOPe Domain Sequences for d1qmka_:

Sequence, based on SEQRES records: (download)

>d1qmka_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
ekgvvdlktiafeshqgflragarliitylapefldwldeen

Sequence, based on observed residues (ATOM records): (download)

>d1qmka_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
eyfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
midgrirdikrglinanlahktfvlsyaakfsgnlygpfcyqlppagrglarralerdms
egadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaaekgvvdlktiafes
hqgflragarliitylapefldwldeen

SCOPe Domain Coordinates for d1qmka_:

Click to download the PDB-style file with coordinates for d1qmka_.
(The format of our PDB-style files is described here.)

Timeline for d1qmka_:

  • d1qmka_ is new in SCOPe 2.06-stable