SCOPe 2.08: Domain d1qlae4: 1qla E:107-239

Lineage for d1qlae4 (1qla E:107-239)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Fumarate reductase [46550] (3 species)

7. Species Wolinella succinogenes [TaxId:844] [46552] (5 PDB entries)

8. Domain d1qlae4: 1qla E:107-239 [302952]
   Other proteins in same PDB: d1qlaa4, d1qlaa5, d1qlaa6, d1qlab3, d1qlac_, d1qlad4, d1qlad5, d1qlad6, d1qlae3, d1qlaf_
   automated match to d1qlbb1
   complexed with ca, f3s, fad, fes, hem, lmt, sf4

Details for d1qlae4

PDB Entry: 1qla, 2.2 Å

PDB Description: respiratory complex ii-like fumarate reductase from wolinella succinogenes

PDB Compounds: (E:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d1qlae4:

Sequence; same for both SEQRES and ATOM records:

>d1qlae4 a.1.2.1 (E:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn

Timeline for d1qlae4:

• d1qlae4 first appeared in SCOPe 2.06
  
• d1qlae4 appears in SCOPe 2.07