Lineage for d1qlaa6 (1qla A:458-655)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696597Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2696598Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2696605Protein Fumarate reductase [46981] (2 species)
  7. 2696617Species Wolinella succinogenes [TaxId:844] [46983] (6 PDB entries)
  8. 2696622Domain d1qlaa6: 1qla A:458-655 [302944]
    Other proteins in same PDB: d1qlaa4, d1qlaa5, d1qlab3, d1qlab4, d1qlac_, d1qlad4, d1qlad5, d1qlae3, d1qlae4, d1qlaf_
    automated match to d1qlba1
    complexed with ca, f3s, fad, fes, hem, lmt, sf4

    has additional insertions and/or extensions that are not grouped together

Details for d1qlaa6

PDB Entry: 1qla (more details), 2.2 Å

PDB Description: respiratory complex ii-like fumarate reductase from wolinella succinogenes
PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d1qlaa6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlaa6 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
kgtedvfkiknrmkdvmddnvgifrdgphleksvkeleelykksknvgiknkrlhanpel
eeayrvpmmlkvalcvakgaldrtesrgahnredypkrddinwlnrtlaswpnpeqtlpt
leyealdvnemeiapryrgygakgnyienplsvkrqeeidkiqseleaagkdrhaiqeal
mpyelpakykarnerlgd

SCOPe Domain Coordinates for d1qlaa6:

Click to download the PDB-style file with coordinates for d1qlaa6.
(The format of our PDB-style files is described here.)

Timeline for d1qlaa6: