Lineage for d1qlaa5 (1qla A:251-371)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001255Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 3001256Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 3001257Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 3001296Protein Fumarate reductase [56429] (2 species)
  7. 3001308Species Wolinella succinogenes [TaxId:844] [56431] (6 PDB entries)
  8. 3001313Domain d1qlaa5: 1qla A:251-371 [302943]
    Other proteins in same PDB: d1qlaa4, d1qlaa6, d1qlab3, d1qlab4, d1qlac_, d1qlad4, d1qlad6, d1qlae3, d1qlae4, d1qlaf_
    automated match to d1qlba3
    complexed with ca, f3s, fad, fes, hem, lmt, sf4

Details for d1qlaa5

PDB Entry: 1qla (more details), 2.2 Å

PDB Description: respiratory complex ii-like fumarate reductase from wolinella succinogenes
PDB Compounds: (A:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d1qlaa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlaa5 d.168.1.1 (A:251-371) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
meavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelasrdvvsrrmie
hirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaekwapvlpmqhy
s

SCOPe Domain Coordinates for d1qlaa5:

Click to download the PDB-style file with coordinates for d1qlaa5.
(The format of our PDB-style files is described here.)

Timeline for d1qlaa5: