Lineage for d1qj2i4 (1qj2 I:178-285)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182994Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2183157Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2183219Family d.87.2.0: automated matches [232089] (1 protein)
    not a true family
  6. 2183220Protein automated matches [232090] (4 species)
    not a true protein
  7. 2183246Species Pseudomonas carboxydovorans [311168] (1 PDB entry)
  8. 2183248Domain d1qj2i4: 1qj2 I:178-285 [302941]
    Other proteins in same PDB: d1qj2a3, d1qj2a4, d1qj2b3, d1qj2b4, d1qj2c3, d1qj2g3, d1qj2g4, d1qj2h3, d1qj2h4, d1qj2i3
    automated match to d1ffuc1
    complexed with fad, fes, pcd

Details for d1qj2i4

PDB Entry: 1qj2 (more details), 2.2 Å

PDB Description: co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (I:) carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1qj2i4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj2i4 d.87.2.0 (I:178-285) automated matches {Pseudomonas carboxydovorans}
ghgyayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgta
ldkpaldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakar

SCOPe Domain Coordinates for d1qj2i4:

Click to download the PDB-style file with coordinates for d1qj2i4.
(The format of our PDB-style files is described here.)

Timeline for d1qj2i4:

  • d1qj2i4 is new in SCOPe 2.06-stable