Lineage for d1qj2i3 (1qj2 I:1-177)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2547890Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2547891Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2548134Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2548135Protein automated matches [191143] (11 species)
    not a true protein
  7. 2548165Species Pseudomonas carboxydovorans [311167] (1 PDB entry)
  8. 2548167Domain d1qj2i3: 1qj2 I:1-177 [302940]
    Other proteins in same PDB: d1qj2a3, d1qj2a4, d1qj2b3, d1qj2b4, d1qj2c4, d1qj2g3, d1qj2g4, d1qj2h3, d1qj2h4, d1qj2i4
    automated match to d1ffuc2
    complexed with fad, fes, pcd

Details for d1qj2i3

PDB Entry: 1qj2 (more details), 2.2 Å

PDB Description: co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (I:) carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1qj2i3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj2i3 d.145.1.0 (I:1-177) automated matches {Pseudomonas carboxydovorans}
mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvppt

SCOPe Domain Coordinates for d1qj2i3:

Click to download the PDB-style file with coordinates for d1qj2i3.
(The format of our PDB-style files is described here.)

Timeline for d1qj2i3: