Lineage for d1qj2h4 (1qj2 H:147-809)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540510Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 2540595Protein automated matches [230468] (3 species)
    not a true protein
  7. 2540622Species Pseudomonas carboxydovorans [311172] (1 PDB entry)
  8. 2540624Domain d1qj2h4: 1qj2 H:147-809 [302939]
    Other proteins in same PDB: d1qj2a3, d1qj2a4, d1qj2b3, d1qj2c3, d1qj2c4, d1qj2g3, d1qj2g4, d1qj2h3, d1qj2i3, d1qj2i4
    automated match to d1n62b2
    complexed with fad, fes, pcd

Details for d1qj2h4

PDB Entry: 1qj2 (more details), 2.2 Å

PDB Description: co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (H:) carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1qj2h4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj2h4 d.133.1.1 (H:147-809) automated matches {Pseudomonas carboxydovorans}
vdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtdatfakaevvskdm
ftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslisglpehkihviapd
igggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfardyhmttelaatkdg
kilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavdgvytnkasggvay
rxsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymaplgweydsgnypla
mkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgagpskncdilgvsmf
dsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimieegntdtapyglg
tygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrfrvkglpekfktmk
elawasynspppnlepgleavnyydppnmtypfgayfcimdididtgvaktrrfyalddc
gtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdfflptavetpkwetdy
tvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmphdawrlwkvgeqlg
lhv

SCOPe Domain Coordinates for d1qj2h4:

Click to download the PDB-style file with coordinates for d1qj2h4.
(The format of our PDB-style files is described here.)

Timeline for d1qj2h4: