![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) ![]() |
![]() | Family d.41.1.0: automated matches [230464] (1 protein) not a true family |
![]() | Protein automated matches [230465] (4 species) not a true protein |
![]() | Species Pseudomonas carboxydovorans [311171] (1 PDB entry) |
![]() | Domain d1qj2b3: 1qj2 B:10-146 [302932] Other proteins in same PDB: d1qj2a3, d1qj2a4, d1qj2b4, d1qj2c3, d1qj2c4, d1qj2g3, d1qj2g4, d1qj2h4, d1qj2i3, d1qj2i4 automated match to d1n62b1 complexed with fad, fes, pcd |
PDB Entry: 1qj2 (more details), 2.2 Å
SCOPe Domain Sequences for d1qj2b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qj2b3 d.41.1.0 (B:10-146) automated matches {Pseudomonas carboxydovorans} tsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariksidt skakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryva adaielvevdyeplpvl
Timeline for d1qj2b3: