Lineage for d1qj2a4 (1qj2 A:82-161)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998451Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 1998452Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 1998453Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 protein domains)
  6. 1998476Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (3 species)
  7. 1998495Species Pseudomonas carboxydovorans [311170] (1 PDB entry)
  8. 1998496Domain d1qj2a4: 1qj2 A:82-161 [302931]
    Other proteins in same PDB: d1qj2a3, d1qj2b3, d1qj2b4, d1qj2c3, d1qj2c4, d1qj2g3, d1qj2h3, d1qj2h4, d1qj2i3, d1qj2i4
    automated match to d1n62a1
    complexed with fad, fes, pcd

Details for d1qj2a4

PDB Entry: 1qj2 (more details), 2.2 Å

PDB Description: co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (A:) carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1qj2a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj2a4 a.56.1.1 (A:82-161) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Pseudomonas carboxydovorans}
apdgtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctg
yqnivkaiqyaaakingvpf

SCOPe Domain Coordinates for d1qj2a4:

Click to download the PDB-style file with coordinates for d1qj2a4.
(The format of our PDB-style files is described here.)

Timeline for d1qj2a4:

  • d1qj2a4 is new in SCOPe 2.06-stable