Lineage for d1qe8a_ (1qe8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134295Protein Thermophilic para-nitrobenzyl esterase (PNB esterase) [53485] (1 species)
  7. 2134296Species Bacillus subtilis [TaxId:1423] [53486] (4 PDB entries)
  8. 2134299Domain d1qe8a_: 1qe8 A: [302929]
    automated match to d1c7ja_
    complexed with k, so4

Details for d1qe8a_

PDB Entry: 1qe8 (more details), 1.6 Å

PDB Description: pnb esterase 56c8
PDB Compounds: (A:) para-nitrobenzyl esterase

SCOPe Domain Sequences for d1qe8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qe8a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]}
thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldataygpvc
pqpsdllslsytelprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgs
klaaqgevivvtlnyrlgpfgfmhlssfdeaysdnlglldqaaalkwvrenisafggdpd
nvtvfgesaggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlgine
sqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgip
lligttrdegylfftsdsdvrsqetldaaleyslgkplaekaadlyprslesqihmvtdl
lfwrpavafasaqshyapvwmyrfdwhpekvpynkafhalelpfvfgnldglermakagi
tdevkqlshtiqsawitfaktgnpsteavnwpayheetretvildseitiendpesekrq
klfps

SCOPe Domain Coordinates for d1qe8a_:

Click to download the PDB-style file with coordinates for d1qe8a_.
(The format of our PDB-style files is described here.)

Timeline for d1qe8a_:

  • d1qe8a_ is new in SCOPe 2.06-stable