Lineage for d1q9va3 (1q9v A:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741086Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (52 PDB entries)
  8. 2741095Domain d1q9va3: 1q9v A:1-107 [302924]
    Other proteins in same PDB: d1q9va4, d1q9vb3, d1q9vb4
    automated match to d3t65a1
    complexed with kdo, mg, zn

Details for d1q9va3

PDB Entry: 1q9v (more details), 1.73 Å

PDB Description: S25-2- Kdo monosaccharide complex
PDB Compounds: (A:) S25-2 Fab (IgG1k) light chain

SCOPe Domain Sequences for d1q9va3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9va3 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikr

SCOPe Domain Coordinates for d1q9va3:

Click to download the PDB-style file with coordinates for d1q9va3.
(The format of our PDB-style files is described here.)

Timeline for d1q9va3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q9va4